Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
N4BP2L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | N4BP2L2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157762
|
Novus Biologicals
NBP157762 |
100 μL |
Each of 1 for $436.00
|
|
Description
N4BP2L2 Polyclonal specifically detects N4BP2L2 in Human samples. It is validated for Western Blot.Specifications
N4BP2L2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
10443 | |
Synthetic peptides corresponding to RP11-298P3.3 (NEDD4 binding protein 2-like 2) The peptide sequence was selected from the N terminal of RP11-298P3.3)(50ug). Peptide sequence EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
CG005FLJ41089, CG016, FLJ36195, NEDD4 binding protein 2-like 2, NEDD4-binding protein 2-like 2, PFAAP5FLJ43077, Phosphonoformate immuno-associated protein 5,92M18.3,92M18.3 (novel protein), protein from BCRA2 region | |
N4BP2L2 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title