Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NARG1L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153124

 View more versions of this product

Catalog No. NBP153124


Add to cart

Description

Description

NARG1L Polyclonal antibody specifically detects NARG1L in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

NARG1L
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
NAA16
Synthetic peptides corresponding to NARG1L(NMDA receptor regulated 1-like) The peptide sequence was selected from the middle region of NARG1L. Peptide sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA.
Immunogen affinity purified
RUO
Primary
79612
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
B0QZ59
FLJ22054, MGC40612, N(alpha)-acetyltransferase 16, NatA auxiliary subunit, N-alpha-acetyltransferase 16, NatA auxiliary subunit, NARG1L, NARG1-like protein, NAT2, NMDA receptor regulated 1-like, NMDA receptor-regulated 1-like protein, PRO2435
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Bovine: 100%; Mouse: 100%; Crab-eating macaque: 92%;.
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit