Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAT9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | NAT9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP153194
|
Novus Biologicals
NBP153194 |
100 μL |
Each of 1 for $436.00
|
|
Description
NAT9 Polyclonal specifically detects NAT9 in Human samples. It is validated for Western Blot.Specifications
NAT9 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZP564C103, EBS, EBSP, hNATL, EC 2.3.1.-, embryo brain specific protein, Embryo brain-specific protein, N-acetyltransferase 9, N-acetyltransferase 9 (GCN5-related, putative) | |
NAT9 | |
IgG | |
Affinity Purified | |
23 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9BTE0 | |
26151 | |
Synthetic peptides corresponding to NAT9(N-acetyltransferase 9 (GCN5-related, putative)) Antibody(against the N terminal of NAT9. Peptide sequence MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title