Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NBPF15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30971725UL

 View more versions of this product

Catalog No. NB124336

Add to cart



NBPF15 Polyclonal specifically detects NBPF15 in Human samples. It is validated for Western Blot.


PBS buffer, 2% sucrose
AB14, Ag3, NBPF16, Neuroblastoma Breakpoint Family Member 15, Neuroblastoma Breakpoint Family Member 16, Neuroblastoma Breakpoint Family, Member 15, Neuroblastoma Breakpoint Family, Member 16
The immunogen is a synthetic peptide directed towards the N-terminal region of human NBPF15 (NP_001164226.1). Peptide sequence VQKLSPENDNDDDEDVQVEVAEKVQKSSAPREMQKAEEKEVPEDSLEECA
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1.0 ug/ml
Affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit