NCF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23350225UL

Catalog No. NB436867

Description

NCF1 Polyclonal specifically detects NCF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NCF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P14598
• Gene Symbols: NCF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 47 kDa neutrophil oxidase factor, FLJ79451, NADPH oxidase organizer 2, NCF-1, NCF1A, neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein, neutrophil cytosolic factor 1, neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1), neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1), Neutrophil NADPH oxidase factor 1, Nox organizer 2, NOXO2NCF-47K, Nox-organizing protein 2, p47phox, SH3 and PX domain-containing protein 1A, SH3PXD1Ap47-phox
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 653361
• Target Species: Human
• Isotype: IgG

For Research Use Only