NCF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258290

Catalog No. NBP258290

Description

NCF4 Polyclonal specifically detects NCF4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NCF4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: MGC3810, NCF, NCF-4, neutrophil cytosol factor 4, neutrophil cytosolic factor 4 (40kD), neutrophil cytosolic factor 4, 40kDa, Neutrophil NADPH oxidase factor 4, p40phox, p40-phox, SH3 and PX domain-containing protein 4, SH3PXD4P40PHOX
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NCF4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 4689
• Target Species: Human
• Isotype: IgG

For Research Use Only