Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCRNA00114 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | NCRNA00114 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170648
|
Novus Biologicals
NBP170648 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
NCRNA00114 Polyclonal specifically detects NCRNA00114 in Human samples. It is validated for Western Blot.Specifications
NCRNA00114 | |
Polyclonal | |
Rabbit | |
Human | |
400866 | |
Synthetic peptides corresponding to NCRNA00114 The peptide sequence was selected from the N terminal of NCRNA00114. Peptide sequence SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C21orf24, long intergenic non-protein coding RNA 114, NCRNA00114 | |
LINC00114 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title