Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCRNA00114 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NCRNA00114 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170648
|
Novus Biologicals
NBP170648 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NCRNA00114 Polyclonal specifically detects NCRNA00114 in Human samples. It is validated for Western Blot.Specifications
| NCRNA00114 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C21orf24, long intergenic non-protein coding RNA 114, NCRNA00114 | |
| LINC00114 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 400866 | |
| Synthetic peptides corresponding to NCRNA00114 The peptide sequence was selected from the N terminal of NCRNA00114. Peptide sequence SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title