NDFIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181234

Catalog No. NBP181234

Description

NDFIP1 Polyclonal specifically detects NDFIP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NDFIP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: Breast cancer-associated protein SGA-1M, MGC10924, N4WBP5Putative NF-kappa-B-activating protein 164, Nedd4 family interacting protein 1, NEDD4 family-interacting protein 1, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NFKB and MAPK-activating protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NDFIP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 80762
• Target Species: Human
• Isotype: IgG

For Research Use Only