Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDFIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | NDFIP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15699020
|
Novus Biologicals
NBP15699020UL |
20 μL |
Each for $152.22
|
|
NBP156990
|
Novus Biologicals
NBP156990 |
100 μL |
Each for $436.00
|
|
Description
NDFIP2 Polyclonal specifically detects NDFIP2 in Human samples. It is validated for Western Blot.Specifications
NDFIP2 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
Q9NV92 | |
54602 | |
Synthetic peptides corresponding to NDFIP2 (Nedd4 family interacting protein 2) The peptide sequence was selected from the middle region of NDFIP2. Peptide sequence SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ25842, KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07, MAPK-activating protein PM04 PM05 PM06 PM07, N4wbp5a, Nedd4 family interacting protein 2, NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, Putative NF-kappa-B-activating protein 413 | |
NDFIP2 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title