NDST4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162254

Catalog No. NBP162254

Description

NDST4 Polyclonal specifically detects NDST4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDST4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 4, HSST4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, NDST-4, N-heparan sulfate sulfotransferase 4, N-HSST 4, NHSST4
• Host Species: Rabbit
• Molecular Weight of Antigen: 101 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H3R1
• Gene Symbols: NDST4
• Immunogen: Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the N terminal of NDST4. Peptide sequence EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64579
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG