Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NDST4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen NDST4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162410
View Documents
Novus Biologicals
NBP162410
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

NDST4 Polyclonal specifically detects NDST4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NDST4
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 4, HSST4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, NDST-4, N-heparan sulfate sulfotransferase 4, N-HSST 4, NHSST4
NDST4
IgG
Affinity Purified
101 kDa
Western Blot
Unconjugated
RUO
Q9H3R1
64579
Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the middle region of NDST4. Peptide sequence YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit