Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDST4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | NDST4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162410
|
Novus Biologicals
NBP162410 |
100 μL |
Each of 1 for $436.00
|
|
Description
NDST4 Polyclonal specifically detects NDST4 in Human samples. It is validated for Western Blot.Specifications
NDST4 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 4, HSST4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, NDST-4, N-heparan sulfate sulfotransferase 4, N-HSST 4, NHSST4 | |
NDST4 | |
IgG | |
Affinity Purified | |
101 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9H3R1 | |
64579 | |
Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the middle region of NDST4. Peptide sequence YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title