Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDST4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | NDST4 |
|---|---|
| Immunogen | Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the middle region of NDST4. Peptide sequence YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16241020 |
Novus Biologicals
NBP16241020UL |
20ul |
Each for $149.00
|
|
NBP162410 |
Novus Biologicals
NBP162410 |
100 ul |
Each for $329.00
|
|
Description
NDST4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| NDST4 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 64579 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the middle region of NDST4. Peptide sequence YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS. | |
| Primary | |
| IgG | |
| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 4, HSST4, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4, NDST-4, N-heparan sulfate sulfotransferase 4, N-HSST 4, NHSST4 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title