Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-NECAB1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP184005

Catalog No. NBP184005


Description

Description

NECAB1 Polyclonal antibody specifically detects NECAB1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

NECAB1
Unconjugated
Affinity Purified
EF hand calcium binding protein 1, EFCBP1, EF-hand calcium binding protein 1, EF-hand calcium-binding protein 1, neuronal calcium binding protein, Neuronal calcium-binding protein 1, N-terminal EF-hand calcium binding protein 1, N-terminal EF-hand calcium-binding protein 1, STIP-1, synaptotagmin interacting protein 1
NECAB1
This antibody was developed against Recombinant Protein corresponding to amino acids:PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVE
Polyclonal
Immunogen affinity purified
RUO
Human,Mouse
Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
64168
Rabbit
IgG
Primary
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only