Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NECAB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156552
Description
NECAB3 Polyclonal specifically detects NECAB3 in Human samples. It is validated for Western Blot.Specifications
NECAB3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
NECAB3 | |
Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug). Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV. | |
100 μL | |
Lipid and Metabolism | |
63941 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Amyloid beta A4 protein-binding family A member 2-binding protein, APBA2BPfamily A, member 2 binding protein, dJ63M2.4, dJ63M2.5, EFCBP3STIP3, EF-hand calcium binding protein 3, Neuronal calcium-binding protein 3, neuronal calcium-binding protein NECAB3, NIP1Nek2-interacting protein 1, N-terminal EF-hand calcium binding protein 3, N-terminal EF-hand calcium-binding protein 3, synaptotagmin interacting protein 2, synaptotagmin interacting protein STIP3, SYTIP2, XB51X11L-binding protein 51 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Rat: 100%; Canine: 92%; Rabbit: 92%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction