NECAB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP156552	Novus Biologicals NBP156552	100 μL

Description

NECAB3 Polyclonal specifically detects NECAB3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NECAB3
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Lipid and Metabolism
• Gene Alias: Amyloid beta A4 protein-binding family A member 2-binding protein, APBA2BPfamily A, member 2 binding protein, dJ63M2.4, dJ63M2.5, EFCBP3STIP3, EF-hand calcium binding protein 3, Neuronal calcium-binding protein 3, neuronal calcium-binding protein NECAB3, NIP1Nek2-interacting protein 1, N-terminal EF-hand calcium binding protein 3, N-terminal EF-hand calcium-binding protein 3, synaptotagmin interacting protein 2, synaptotagmin interacting protein STIP3, SYTIP2, XB51X11L-binding protein 51
• Gene Symbols: NECAB3
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene ID (Entrez): 63941
• Immunogen: Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug). Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.