Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NECAP1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | NECAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17958320
|
Novus Biologicals
NBP17958320UL |
20 μL |
Each for $152.22
|
|
NBP179583
|
Novus Biologicals
NBP179583 |
100 μL |
Each for $436.00
|
|
Description
NECAP1 Polyclonal specifically detects NECAP1 in Mouse samples. It is validated for Western Blot.Specifications
| NECAP1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| adaptin ear-binding coat-associated protein 1, adaptin-ear-binding coat-associated protein 1, DKFZP566B183, MGC131900, NECAP endocytosis associated 1, NECAP endocytosis-associated protein 1, NECAP-1 | |
| NECAP1 | |
| IgG | |
| Affinity Purified | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_080543 | |
| 25977 | |
| Synthetic peptide directed towards the N terminal of human Necap1The immunogen for this antibody is Necap1. Peptide sequence RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title