Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Necdin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Necdin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158244
|
Novus Biologicals
NBP158244 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Necdin Polyclonal specifically detects Necdin in Human samples. It is validated for Western Blot.Specifications
| Necdin | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| Q99608 | |
| 4692 | |
| Synthetic peptides corresponding to NDN(necdin homolog (mouse)) The peptide sequence was selected from the middle region of NDN. Peptide sequence VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HsT16328, necdin, necdin (mouse) homolog, necdin homolog (mouse), PWCR | |
| NDN | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title