Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NEDD8 Activating Enzyme (APPBP1/UBA3) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen NEDD8 Activating Enzyme (APPBP1/UBA3)
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124884
View Documents
Novus Biologicals
NBP30999125UL
25 μg
Each for $106.19
Add to cart
 
NB124883
View Documents
Novus Biologicals
NBP309991100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

NEDD8 Activating Enzyme (APPBP1/UBA3) Polyclonal antibody specifically detects NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse samples. It is validated for Western Blot
Specifications

Specifications

NEDD8 Activating Enzyme (APPBP1/UBA3)
Western Blot
Purified
RUO
Mouse
A-116A10.1, amyloid beta precursor protein binding protein 1, amyloid beta precursor protein binding protein 1, 59kDa, Amyloid beta precursor protein-binding protein 1, 59 kDa, amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, APPBP1APP-BP1, NEDD8 activating enzyme E1 subunit 1, NEDD8-activating enzyme E1 regulatory subunit, NEDD8-activating enzyme E1 subunit, protooncogene protein 1, Proto-oncogene protein 1, ula-1
The immunogen is a synthetic peptide directed towards the middle region of mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_001018169.1). Peptide sequence KNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Apoptosis
PBS buffer, 2% sucrose
8883
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit