Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEDD8 Activating Enzyme (APPBP1/UBA3) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$106.19 - $352.89
 Antibody-Western Blot-NBP3-09381-img0001.jpg-650.jpg)
Specifications
| Antigen | NEDD8 Activating Enzyme (APPBP1/UBA3) |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Format | Purified |
Description
NEDD8 Activating Enzyme (APPBP1/UBA3) Polyclonal antibody specifically detects NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse samples. It is validated for Western BlotSpecifications
| NEDD8 Activating Enzyme (APPBP1/UBA3) | |
| Western Blot | |
| Purified | |
| RUO | |
| Mouse | |
| A-116A10.1, amyloid beta precursor protein binding protein 1, amyloid beta precursor protein binding protein 1, 59kDa, Amyloid beta precursor protein-binding protein 1, 59 kDa, amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, APPBP1APP-BP1, NEDD8 activating enzyme E1 subunit 1, NEDD8-activating enzyme E1 regulatory subunit, NEDD8-activating enzyme E1 subunit, protooncogene protein 1, Proto-oncogene protein 1, ula-1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_659180). Peptide sequence ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Unconjugated | |
| Rabbit | |
| Apoptosis | |
| PBS buffer, 2% sucrose | |
| 8883 | |
| Polyclonal | |
| Affinity purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title