NEDP1/SENP8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406694	Novus Biologicals NBP18525925UL	25ul
NBP185259	Novus Biologicals NBP185259	0.1 mL

Description

NEDP1/SENP8 Polyclonal specifically detects NEDP1/SENP8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NEDP1/SENP8
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 123228
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: DEN1deneddylase-1, deneddylase 1, Deneddylase-1, EC 3.4.22.-, HsT17512, NEDD8-specific protease 1, NEDP1NEDD8 specific-protease cysteine 2, Protease, cysteine 2, protease, cysteine, 2 (NEDD8 specific), PRSC2, Sentrin/SUMO-specific protease SENP8, sentrin-specific protease 8, SUMO sentrin specific protease family member 8, SUMO/sentrin specific peptidase family member 8, SUMO/sentrin specific protease family member 8
• Gene Symbols: SENP8
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only