Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEK10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310139100UL
Description
NEK10 Polyclonal specifically detects NEK10 in Mouse samples. It is validated for Western Blot.Specifications
NEK10 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FLJ32685, NIMA (never in mitosis gene a)- related kinase 10 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse NEK10 (NP_001182158.1). Peptide sequence HLGSGAFGCVYKVRKRSGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVS | |
100 μg | |
Protein Kinase | |
152110 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction