Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NEK5 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen NEK5
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125261
View Documents
Novus Biologicals
NBP310180100UL
100 μg N/A
NB125262
View Documents
Novus Biologicals
NBP31018025UL
25 μg N/A
Description

Description

NEK5 Polyclonal antibody specifically detects NEK5 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

NEK5
Western Blot
Purified
RUO
Mouse
never in mitosis A-related kinase 5, NIMA (never in mitosis gene a)-related kinase 5, nimA-related protein kinase 5, serine/threonine-protein kinase Nek5
The immunogen is a synthetic peptide directed towards the middle region of mouse NEK5 (NP_808566.2). Peptide sequence SVEPHPNEGEKLQSHWEETKFQELQYRKNKMKDQEYWKQLEEIRQQYHND
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Protein Kinase
PBS buffer, 2% sucrose
341676
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit