Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NELF Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NELF |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154835
|
Novus Biologicals
NBP154835 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NELF Polyclonal specifically detects NELF in Human samples. It is validated for Western Blot.Specifications
| NELF | |
| Polyclonal | |
| Purified | |
| RUO | |
| nasal embryonic LHRH factorMGC125369, nasal embryonic luteinizing hormone-releasing hormone factor | |
| Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the middle region of NELF. Peptide sequence RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 26012 | |
| IgG | |
| Protein A purified | |
| 29 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title