Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Neprilysin-2/MMEL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Neprilysin-2/MMEL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15934920
View Documents
Novus Biologicals
NBP15934920UL
20 μL
Each for $152.22
Add to cart
 
NBP159349
View Documents
Novus Biologicals
NBP159349
100 μL
Each for $436.00
Add to cart
 
Description

Description

Neprilysin-2/MMEL1 Polyclonal specifically detects Neprilysin-2/MMEL1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Neprilysin-2/MMEL1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
79258
Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
EC 3.4.24, EC 3.4.24.11, MELL1, membrane metallo-endopeptidase-like 1, Membrane metallo-endopeptidase-like 2MGC119455, MGC119454, MMEL2, NEP2, NEP2(m), NEPIIMGC119456, Neprilysin II, Neprilysin-2, NL2NL1, SEP, soluble secreted endopeptidase, zinc metallopeptidase
MMEL1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit