Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nesprin-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15976720UL
Description
Nesprin-4 Polyclonal specifically detects Nesprin-4 in Human samples. It is validated for Western Blot.Specifications
Nesprin-4 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8N205 | |
SYNE4 | |
Synthetic peptides corresponding to Nesprin-4 The peptide sequence was selected from the N terminal of Nesprin-4. Peptide sequence GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 19 open reading frame 46, FLJ36445, nesprin-4 | |
Rabbit | |
Affinity Purified | |
RUO | |
163183 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction