Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nesprin-4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$175.82 - $436.00
Specifications
Antigen | Nesprin-4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15976720
|
Novus Biologicals
NBP15976720UL |
20 μL |
Each for $175.82
|
|
NBP159767
|
Novus Biologicals
NBP159767 |
100 μL |
Each for $436.00
|
|
Description
Nesprin-4 Polyclonal specifically detects Nesprin-4 in Human samples. It is validated for Western Blot.Specifications
Nesprin-4 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 19 open reading frame 46, FLJ36445, nesprin-4 | |
SYNE4 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q8N205 | |
163183 | |
Synthetic peptides corresponding to Nesprin-4 The peptide sequence was selected from the N terminal of Nesprin-4. Peptide sequence GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title