Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Nestin Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP259775PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nestin The Nestin Recombinant Protein Antigen is derived from E. coli. The Nestin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP | |
NES Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4 | |
FLJ21841, NES, Nestin | |
Unlabeled | |
Recombinant Protein Antigen | |
RUO | |
Human |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20°C long term. Avoid freeze-thaw cycles. | |
AC | |
NES | |
34 kDa | |
0.1mL | |
E.coli |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only.
Spot an opportunity for improvement?
Provide Content Correction