Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEU2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310993100UL
Description
NEU2 Polyclonal specifically detects NEU2 in Human samples. It is validated for Immunohistochemistry.Specifications
NEU2 | |
Polyclonal | |
Immunohistochemistry | |
Cytosolic sialidase, EC 3.2.1.18, N-acetyl-alpha-neuraminidase 2, neuraminidase 2, SIAL2MGC129579, sialidase 2 (cytosolic sialidase), sialidase-2 | |
The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH (NP_005374). Peptide sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH | |
100 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
4759 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction