Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NEUROD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258800

Catalog No. NBP258800


Add to cart

Description

Description

NEUROD4 Polyclonal antibody specifically detects NEUROD4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

NEUROD4
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
ATH3BHLHA4, ATH-3Protein atonal homolog 3, Atoh3neurogenic differentiation factor 4, bHLHa4ATOH3, Class A basic helix-loop-helix protein 4, MATH-3, NeuroD4, neurogenic differentiation 4
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry (Paraffin)
Immunohistochemistry-Paraffin 1:50 - 1:200
Affinity Purified
NEUROD4
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT
Affinity purified
RUO
Primary
58158
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only