Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuronatin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Neuronatin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15701520
|
Novus Biologicals
NBP15701520UL |
20 μL |
Each for $152.22
|
|
NBP157015
|
Novus Biologicals
NBP157015 |
100 μL |
Each for $436.00
|
|
Description
Neuronatin Polyclonal specifically detects Neuronatin in Human samples. It is validated for Western Blot.Specifications
| Neuronatin | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC1439, neuronatin, Peg5 | |
| NNAT | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q16517-2 | |
| 4826 | |
| Synthetic peptides corresponding to NNAT (neuronatin) The peptide sequence was selected from the middle region of NNAT. Peptide sequence MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title