NFKBID Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179856

Catalog No. NBP179856

Description

NFKBID Polyclonal specifically detects NFKBID in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NFKBID
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_640332
• Gene Symbols: NFKBID
• Immunogen: Synthetic peptide directed towards the C terminal of human NFKBIDThe immunogen for this antibody is NFKBID. Peptide sequence QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: delta, IkappaBdelta, I-kappa-B-delta, IkappaBNSikappaBdelta, ikB-delta, IKBNS, MGC11314, MGC149503, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, TA-NFKBHNF-kappa-B inhibitor delta, T-cell activation NFKB-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 84807
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG