Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NFKBID Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17985620UL
Description
NFKBID Polyclonal specifically detects NFKBID in Human samples. It is validated for Western Blot.Specifications
NFKBID | |
Polyclonal | |
Western Blot 1:1000 | |
NP_640332 | |
NFKBID | |
Synthetic peptide directed towards the C terminal of human NFKBIDThe immunogen for this antibody is NFKBID. Peptide sequence QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP. | |
Affinity Purified | |
RUO | |
84807 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
delta, IkappaBdelta, I-kappa-B-delta, IkappaBNSikappaBdelta, ikB-delta, IKBNS, MGC11314, MGC149503, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, TA-NFKBHNF-kappa-B inhibitor delta, T-cell activation NFKB-like protein | |
Rabbit | |
33 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title