Novus Biologicals™ NFRKB Protein 2

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP185096PEP

Catalog No. NBP185096PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFRKB. The NFRKB Recombinant Protein Antigen is derived from E. coli. The NFRKB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-85096. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Concentration: 0.5mg/mL
• Formulation: PBS and 1M Urea, pH 7.4.
• Molecular Weight: 31kDa
• Purity: >80%
• Source: E.Coli
• Storage Requirements: Store at -20°C. Avoid freeze-thaw cycles.
• Gene Symbol: NFRKB
• Conjugate: Unlabeled
• Recombinant: Yes

• For Use With (Application): Blocking/Neutralizing, Control
• Gene ID (Entrez): 4798
• Purification Method: Chromatography
• Quantity: 0.1mL
• Immunogen: SLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPVPRVRTDYVVRPS
• Regulatory Status: RUO
• Product Type: NFRKB
• Host Species: Human

Safety and Handling

ShelfLife : 365

For Research Use Only