Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ NFX1 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258058PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFX1. Source: E.coli Amino Acid Sequence: KELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVYHSCHSEEKCPPCTFLTQKWC The NFX1 Recombinant Protein Antigen is derived from E. coli. The NFX1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
4799 | |
NFX1 Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4. | |
DKFZp779G2416, EC 6.3.2.-, MGC20369, NFX2transcriptional repressor NF-X1, Nuclear transcription factor, X box-binding protein 1, nuclear transcription factor, X-box binding 1 | |
Unlabeled | |
100μL | |
E.Coli |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
NFX1 | |
Recombinant Protein Antigen | |
RUO | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction