Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NGL-1/LRRC4C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15966920UL
Description
NGL-1/LRRC4C Polyclonal specifically detects NGL-1/LRRC4C in Human samples. It is validated for Western Blot.Specifications
NGL-1/LRRC4C | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9HCJ2 | |
LRRC4C | |
Synthetic peptides corresponding to LRRC4C(leucine rich repeat containing 4C) The peptide sequence was selected from the N terminal of LRRC4C. Peptide sequence LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE. | |
Affinity Purified | |
RUO | |
57689 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA1580NGL-1NGL1Netrin-G1 ligand, leucine rich repeat containing 4C, leucine-rich repeat-containing protein 4C | |
Rabbit | |
72 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction