Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NGL-1/LRRC4C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00


Antigen NGL-1/LRRC4C
Immunogen Synthetic peptides corresponding to LRRC4C(leucine rich repeat containing 4C) The peptide sequence was selected from the N terminal of LRRC4C. Peptide sequence LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15966920 View Documents Novus BiologicalsSupplier Diversity Partner
20ul Each for $149.00
Add to cart
NBP159669 View Documents Novus BiologicalsSupplier Diversity Partner
100 ul Each for $329.00
Add to cart


NGL-1/LRRC4C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Affinity Purified
Western Blot
Synthetic peptides corresponding to LRRC4C(leucine rich repeat containing 4C) The peptide sequence was selected from the N terminal of LRRC4C. Peptide sequence LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE.
KIAA1580NGL-1NGL1Netrin-G1 ligand, leucine rich repeat containing 4C, leucine-rich repeat-containing protein 4C
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit