Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NHA2/SLC9B2/NHEDC2 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | NHA2/SLC9B2/NHEDC2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15957920
|
Novus Biologicals
NBP15957920UL |
20 μL |
Each for $152.22
|
|
NBP159579
|
Novus Biologicals
NBP159579 |
100 μL |
Each for $436.00
|
|
Description
NHA2/SLC9B2/NHEDC2 Polyclonal specifically detects NHA2/SLC9B2/NHEDC2 in Human, Mouse samples. It is validated for Western Blot.Specifications
NHA2/SLC9B2/NHEDC2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ23984, Mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, NHA2NHE10, NHE domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2 | |
SLC9B2 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q86UD5 | |
133308 | |
Synthetic peptides corresponding to NHEDC2(Na+/H+ exchanger domain containing 2) The peptide sequence was selected from the C terminal of NHEDC2. Peptide sequence IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title