Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NHE8 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310574100UL

 View more versions of this product

Catalog No. NB126049


Add to cart

Description

Description

NHE8 Polyclonal specifically detects NHE8 in Rat samples. It is validated for Western Blot.
Specifications

Specifications

NHE8
Unconjugated
PBS buffer, 2% sucrose
DKFZp686C03237, KIAA0939DKFZp686C03237, MGC138418, Na(+)/H(+) exchanger 8, NHE-8, NHE8FLJ42500, sodium/hydrogen exchanger 8, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 8, solute carrier family 9 (sodium/hydrogen exchanger), member 8, Solute carrier family 9 member 8
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat NHE8 (NP_001020452). Peptide sequence LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF
100 μg
Cellular Markers, Golgi Apparatus Markers, Lipid and Metabolism
Primary
23315
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Rat
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit