Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NHE8 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | NHE8 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126049
|
Novus Biologicals
NBP310574100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
NHE8 Polyclonal specifically detects NHE8 in Rat samples. It is validated for Western Blot.Specifications
| NHE8 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers, Golgi Apparatus Markers, Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 23315 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Rat | |
| DKFZp686C03237, KIAA0939DKFZp686C03237, MGC138418, Na(+)/H(+) exchanger 8, NHE-8, NHE8FLJ42500, sodium/hydrogen exchanger 8, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 8, solute carrier family 9 (sodium/hydrogen exchanger), member 8, Solute carrier family 9 member 8 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Rat NHE8 (NP_001020452). Peptide sequence LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title