Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NHERF-2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191569

 View more versions of this product

Catalog No. NBP191569


Add to cart

Description

Description

NHERF-2 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

NHERF-2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SLC9A3R2
Synthetic peptide directed towards the N terminal of human Slc9a3r2. Peptide sequence RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV.
Immunogen affinity purified
RUO
Primary
9351
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_446263
E3KARP, Na(+)/H(+) exchange regulatory cofactor NHE-RF2, NHE3RF2, NHERF2MGC104639, NHERF-2NHE3 kinase A regulatory protein E3KARP, OCTS2, SIP-1SRY-interacting protein 1, sodium/hydrogen exchanger, Sodium-hydrogen exchanger regulatory factor 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2, solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2, Solute carrier family 9 isoform A3 regulatory factor 2, TKA-1SIP1, Tyrosine kinase activator protein 1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Pig: 92%; Xenopus: 90%.
Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit