Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nicotinic Acetylcholine R alpha 5/CHRNA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $379.00

Specifications

Antigen Nicotinic Acetylcholine R alpha 5/CHRNA5
Immunogen Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1692220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16912220UL
20ul Each for $149.00
Add to cart
 
NBP169122 View Documents Novus BiologicalsSupplier Diversity Partner
NBP169122
100 ul Each for $379.00
Add to cart
 
Description

Description

Nicotinic Acetylcholine R alpha 5/CHRNA5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Nicotinic Acetylcholine R alpha 5/CHRNA5
Rabbit
Polyclonal
Unconjugated
1138
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD.
Primary
IgG
Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5, cholinergic receptor, nicotinic, alpha 5, cholinergic receptor, nicotinic, alpha polypeptide 5, LNCR2, NACHRA5, neuronal acetylcholine receptor subunit alpha-5, neuronal nicotinic acetylcholine receptor, alpha5 subunit
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit