Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | NIF1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125923
|
Novus Biologicals
NBP310511100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
NIF1 Polyclonal specifically detects NIF1 in Human samples. It is validated for Western Blot.Specifications
| NIF1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DKFZp586G1122, Hzf, HZFzinc finger protein 385, RZFHematopoietic zinc finger protein, ZFP385, zinc finger protein 385A, ZNF385Retinal zinc finger protein | |
| The immunogen is a synthetic peptide directed towards the middle region of human NIF1 (NP_071378). Peptide sequence EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 63925 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title