Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIP7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NIP7 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157435
|
Novus Biologicals
NBP157435 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NIP7 Polyclonal specifically detects NIP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NIP7 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CGI-37,60S ribosome subunit biogenesis protein NIP7 homolog, HSPC031, KD93FLJ10296, nuclear import 7 homolog (S. cerevisiae) | |
| NIP7 | |
| IgG | |
| Protein A purified | |
| This product is specific to Subunit or Isoform: biogenesis protein NIP7 homolog. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| Q9Y221 | |
| 51388 | |
| Synthetic peptides corresponding to NIP7 (nuclear import 7 homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of NIP7. Peptide sequence VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title