NKCC1/SLC12A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159430

Catalog No. NBP159430

Description

NKCC1/SLC12A2 Polyclonal specifically detects NKCC1/SLC12A2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NKCC1/SLC12A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Basolateral Na-K-Cl symporter, BSC, BSC2, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1, NKCC1MGC104233, solute carrier family 12 (sodium/potassium/chloride transporters), member 2, solute carrier family 12 member 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 131 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 91%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P55011
• Gene Symbols: SLC12A2
• Immunogen: Synthetic peptides corresponding to SLC12A2(solute carrier family 12 (sodium/potassium/chloride transporters), member 2) The peptide sequence was selected from the C terminal of SLC12A2 (NP_001037). Peptide sequence IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6558
• Reconstitution: Reconstitute with 100μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only