Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NKG2A/CD159a/KLRC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen NKG2A/CD159a/KLRC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP174093
View Documents
Novus Biologicals
NBP174093
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

NKG2A/CD159a/KLRC1 Polyclonal specifically detects NKG2A/CD159a/KLRC1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NKG2A/CD159a/KLRC1
Polyclonal
Rabbit
Signal Transduction
PBS and 2% Sucrose with 0.09% Sodium Azide
CD159 antigen-like family member A, CD159A, CD159a antigen, C-lectin type II protein, killer cell lectin-like receptor subfamily C, member 1, MGC13374, natural killer cell lectin, natural killer group protein 2, NK cell receptor A, NKG2, NKG2-1/B activating NK receptor, NKG2-A, NKG2-A/B type II integral membrane protein, NKG2-A/B-activating NK receptor, NKG2-A/NKG2-B type II integral membrane protein, NKG2AMGC59791, NKG2-B
KLRC1
IgG
Affinity Purified
24 kDa
Western Blot
Unconjugated
RUO
Human
P26715-2
3821
Synthetic peptides corresponding to the C terminal of KLRC1. Immunizing peptide sequence SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit