Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NKG2A/CD159a/KLRC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NKG2A/CD159a/KLRC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174093
|
Novus Biologicals
NBP174093 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NKG2A/CD159a/KLRC1 Polyclonal specifically detects NKG2A/CD159a/KLRC1 in Human samples. It is validated for Western Blot.Specifications
| NKG2A/CD159a/KLRC1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CD159 antigen-like family member A, CD159A, CD159a antigen, C-lectin type II protein, killer cell lectin-like receptor subfamily C, member 1, MGC13374, natural killer cell lectin, natural killer group protein 2, NK cell receptor A, NKG2, NKG2-1/B activating NK receptor, NKG2-A, NKG2-A/B type II integral membrane protein, NKG2-A/B-activating NK receptor, NKG2-A/NKG2-B type II integral membrane protein, NKG2AMGC59791, NKG2-B | |
| KLRC1 | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| P26715-2 | |
| 3821 | |
| Synthetic peptides corresponding to the C terminal of KLRC1. Immunizing peptide sequence SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title