Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ NKp46/NCR1 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258055PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKp46/NCR1. Source: E.coli Amino Acid Sequence: TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT The NKp46/NCR1 Recombinant Protein Antigen is derived from E. coli. The NKp46/NCR1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 9437 | |
| NKp46/NCR1 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46 | |
| Unlabeled | |
| 100μL | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| NCR1 | |
| Recombinant Protein Antigen | |
| RUO | |
| Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only