Novus Biologicals™ NKp46/NCR1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258055PEP

Catalog No. NBP258055PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKp46/NCR1. Source: E.coli Amino Acid Sequence: TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT The NKp46/NCR1 Recombinant Protein Antigen is derived from E. coli. The NKp46/NCR1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 9437
• Common Name: NKp46/NCR1 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.Coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: NCR1
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51614. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only