Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLRP1/NALP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257196

Catalog No. NBP257196


Add to cart

Description

Description

NLRP1/NALP1 Polyclonal antibody specifically detects NLRP1/NALP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

NLRP1/NALP1
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
Rabbit
IgG
100 ul
Apoptosis
Primary
22861
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
NLRP1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only