Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TXNDC16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19133920UL
Description
TXNDC16 Polyclonal specifically detects TXNDC16 in Human samples. It is validated for Western Blot.Specifications
TXNDC16 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
NP_065835 | |
TXNDC16 | |
Synthetic peptide directed towards the N terminal of human TXNDC16. Peptide sequence EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA1344, thioredoxin domain containing 16, thioredoxin domain-containing protein 16 | |
Rabbit | |
Affinity Purified | |
RUO | |
57544 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction