Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GNPTAB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$501.50

Specifications

Antigen	GNPTAB
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP191347 View Documents View Product Certificates	Novus Biologicals NBP191347	100 μL	Each of 1 for $501.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GNPTAB Polyclonal specifically detects GNPTAB in Human samples. It is validated for Western Blot.

Specifications

Antigen	GNPTAB
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q3T906
Gene ID (Entrez)	79158
Immunogen	Synthetic peptide directed towards the N terminal of human GNPTAB (NP_077288). Peptide sequence FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp762B226, GlcNAc phosphotransferase, glucosamine (UDP-N-acetyl)-lysosomal-enzyme N-acetylglucosamine phosphotransferase, GNPTA, ICD, KIAA1208, MGC4170, N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits, stealth protein GNPTAB, UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosamine
Gene Symbols	GNPTAB
Isotype	IgG
Molecular Weight of Antigen	144 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GNPTAB Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents