Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NOC3L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	NOC3L
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP156497 View Documents View Product Certificates	Novus Biologicals NBP156497	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NOC3L Polyclonal specifically detects NOC3L in Human samples. It is validated for Western Blot.

Specifications

Antigen	NOC3L
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Protein Kinase
Gene Alias	AD24NOC3-like protein, C10orf117, chromosome 10 open reading frame 117, Factor for adipocyte differentiation 24, FAD24NOC3 protein homolog, FLJ12820, nucleolar complex associated 3 homolog (S. cerevisiae), nucleolar complex protein 3 homolog, Nucleolar complex-associated protein 3-like protein
Gene Symbols	NOC3L
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q8WTT2
Gene ID (Entrez)	64318
Immunogen	Synthetic peptides corresponding to NOC3L(nucleolar complex associated 3 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOC3L. Peptide sequence TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NOC3L Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents