NOC3L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156497

Catalog No. NBP156497

Description

NOC3L Polyclonal specifically detects NOC3L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NOC3L
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WTT2
• Gene Symbols: NOC3L
• Immunogen: Synthetic peptides corresponding to NOC3L(nucleolar complex associated 3 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOC3L. Peptide sequence TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 64318
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AD24NOC3-like protein, C10orf117, chromosome 10 open reading frame 117, Factor for adipocyte differentiation 24, FAD24NOC3 protein homolog, FLJ12820, nucleolar complex associated 3 homolog (S. cerevisiae), nucleolar complex protein 3 homolog, Nucleolar complex-associated protein 3-like protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG